Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for hansvandenhof 51. hansvandenhof Lv 1 19 pts. 9,619
  2. Avatar for pvc78 52. pvc78 Lv 1 18 pts. 9,616
  3. Avatar for joremen 53. joremen Lv 1 17 pts. 9,609
  4. Avatar for johngran 54. johngran Lv 1 17 pts. 9,601
  5. Avatar for O Seki To 55. O Seki To Lv 1 16 pts. 9,596
  6. Avatar for Glen B 56. Glen B Lv 1 15 pts. 9,583
  7. Avatar for MicElephant 57. MicElephant Lv 1 15 pts. 9,578
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 14 pts. 9,559
  9. Avatar for cobaltteal 59. cobaltteal Lv 1 13 pts. 9,557
  10. Avatar for Vinara 60. Vinara Lv 1 13 pts. 9,554

Comments