Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444
  1. Avatar for hansvandenhof 41. hansvandenhof Lv 1 17 pts. 9,266
  2. Avatar for andrewxc 42. andrewxc Lv 1 17 pts. 9,261
  3. Avatar for MicElephant 43. MicElephant Lv 1 16 pts. 9,240
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 15 pts. 9,219
  5. Avatar for joremen 45. joremen Lv 1 14 pts. 9,207
  6. Avatar for jobo0502 46. jobo0502 Lv 1 13 pts. 9,207
  7. Avatar for isaksson 47. isaksson Lv 1 13 pts. 9,180
  8. Avatar for alcor29 48. alcor29 Lv 1 12 pts. 9,162
  9. Avatar for toshiue 49. toshiue Lv 1 11 pts. 9,160
  10. Avatar for Vinara 50. Vinara Lv 1 11 pts. 9,150

Comments