Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,508
  2. Avatar for xkcd 12. xkcd 1 pt. 9,401
  3. Avatar for freefolder 13. freefolder 1 pt. 9,393
  4. Avatar for Deleted group 14. Deleted group pts. 9,288
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,124

  1. Avatar for joremen 71. joremen Lv 1 5 pts. 9,610
  2. Avatar for ViJay7019 72. ViJay7019 Lv 1 4 pts. 9,605
  3. Avatar for Crossed Sticks 73. Crossed Sticks Lv 1 4 pts. 9,602
  4. Avatar for alwen 74. alwen Lv 1 4 pts. 9,592
  5. Avatar for Fog Darts 75. Fog Darts Lv 1 4 pts. 9,584
  6. Avatar for Festering Wounds 76. Festering Wounds Lv 1 4 pts. 9,547
  7. Avatar for isaksson 77. isaksson Lv 1 3 pts. 9,546
  8. Avatar for YeshuaLives 78. YeshuaLives Lv 1 3 pts. 9,541
  9. Avatar for mcatneuro1 79. mcatneuro1 Lv 1 3 pts. 9,536
  10. Avatar for Vincera 80. Vincera Lv 1 3 pts. 9,532

Comments