1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Summary

• Created: August 17, 2017
• Expires: August 24, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

• 1. Gargleblasters 100 pts. 10,034
• 2. Contenders 70 pts. 10,016
• 3. Marvin's bunch 47 pts. 9,968
• 4. L'Alliance Francophone 30 pts. 9,897
• 5. Beta Folders 19 pts. 9,897
• 6. Anthropic Dreams 11 pts. 9,893
• 7. Go Science 7 pts. 9,838
• 8. Void Crushers 4 pts. 9,819
• 9. Italiani Al Lavoro 2 pts. 9,720
• 10. Kotocycle 1 pt. 9,519

Top soloists

• 71. joremen 5 pts. 9,610
• 72. ViJay7019 4 pts. 9,605
• 73. Crossed Sticks 4 pts. 9,602
• 74. alwen 4 pts. 9,592
• 75. Fog Darts 4 pts. 9,584
• 76. Festering Wounds 4 pts. 9,547
• 77. isaksson 3 pts. 9,546
• 78. YeshuaLives 3 pts. 9,541
• 79. mcatneuro1 3 pts. 9,536
• 80. Vincera 3 pts. 9,532