Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 9,656
  2. Avatar for :) 12. :) 1 pt. 9,468
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,278
  4. Avatar for Deleted group 14. Deleted group pts. 9,153
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,127
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 9,036
  7. Avatar for Window Group 17. Window Group 1 pt. 8,310
  1. Avatar for rinze 111. rinze Lv 1 1 pt. 9,287
  2. Avatar for senor pit 112. senor pit Lv 1 1 pt. 9,281
  3. Avatar for Jajaboman 113. Jajaboman Lv 1 1 pt. 9,278
  4. Avatar for Radeodem8 114. Radeodem8 Lv 1 1 pt. 9,249
  5. Avatar for multaq 115. multaq Lv 1 1 pt. 9,236
  6. Avatar for spiveyds 116. spiveyds Lv 1 1 pt. 9,227
  7. Avatar for hunterl 117. hunterl Lv 1 1 pt. 9,207
  8. Avatar for DScott 118. DScott Lv 1 1 pt. 9,205
  9. Avatar for deathbat_87 119. deathbat_87 Lv 1 1 pt. 9,200
  10. Avatar for skracked 120. skracked Lv 1 1 pt. 9,167

Comments