Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714
  1. Avatar for rinze 111. rinze Lv 1 1 pt. 9,287
  2. Avatar for senor pit 112. senor pit Lv 1 1 pt. 9,281
  3. Avatar for Jajaboman 113. Jajaboman Lv 1 1 pt. 9,278
  4. Avatar for Radeodem8 114. Radeodem8 Lv 1 1 pt. 9,249
  5. Avatar for multaq 115. multaq Lv 1 1 pt. 9,236
  6. Avatar for spiveyds 116. spiveyds Lv 1 1 pt. 9,227
  7. Avatar for hunterl 117. hunterl Lv 1 1 pt. 9,207
  8. Avatar for DScott 118. DScott Lv 1 1 pt. 9,205
  9. Avatar for deathbat_87 119. deathbat_87 Lv 1 1 pt. 9,200
  10. Avatar for skracked 120. skracked Lv 1 1 pt. 9,167

Comments