Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for jobo0502 41. jobo0502 Lv 1 17 pts. 8,288
  2. Avatar for SKSbell 42. SKSbell Lv 1 16 pts. 8,287
  3. Avatar for nathanmills 43. nathanmills Lv 1 15 pts. 8,255
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 15 pts. 8,254
  5. Avatar for senor pit 45. senor pit Lv 1 14 pts. 8,251
  6. Avatar for bzipitidoo 46. bzipitidoo Lv 1 13 pts. 8,244
  7. Avatar for Timo van der Laan 47. Timo van der Laan Lv 1 12 pts. 8,238
  8. Avatar for katling 48. katling Lv 1 12 pts. 8,235
  9. Avatar for hpaege 49. hpaege Lv 1 11 pts. 8,230
  10. Avatar for diamonddays 50. diamonddays Lv 1 11 pts. 8,225

Comments