Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for Merf 31. Merf Lv 1 28 pts. 8,388
  2. Avatar for alcor29 32. alcor29 Lv 1 27 pts. 8,381
  3. Avatar for Maerlyn138 33. Maerlyn138 Lv 1 26 pts. 8,341
  4. Avatar for pauldunn 34. pauldunn Lv 1 25 pts. 8,336
  5. Avatar for jausmh 35. jausmh Lv 1 23 pts. 8,336
  6. Avatar for multaq 36. multaq Lv 1 22 pts. 8,328
  7. Avatar for rabamino12358 37. rabamino12358 Lv 1 21 pts. 8,325
  8. Avatar for Deleted player 38. Deleted player pts. 8,319
  9. Avatar for weitzen 39. weitzen Lv 1 19 pts. 8,313
  10. Avatar for yoyoparis 40. yoyoparis Lv 1 18 pts. 8,297

Comments