Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for leehaggis 81. leehaggis Lv 1 2 pts. 8,006
  2. Avatar for aspadistra 82. aspadistra Lv 1 1 pt. 7,999
  3. Avatar for gurch 83. gurch Lv 1 1 pt. 7,969
  4. Avatar for aquaticflames 84. aquaticflames Lv 1 1 pt. 7,964
  5. Avatar for spritz1992 85. spritz1992 Lv 1 1 pt. 7,960
  6. Avatar for Mike Cassidy 86. Mike Cassidy Lv 1 1 pt. 7,943
  7. Avatar for Petry 87. Petry Lv 1 1 pt. 7,929
  8. Avatar for NotJim99 88. NotJim99 Lv 1 1 pt. 7,926
  9. Avatar for lamoille 89. lamoille Lv 1 1 pt. 7,921
  10. Avatar for Vincera 90. Vincera Lv 1 1 pt. 7,918

Comments