Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,979
  2. Avatar for phi16 2. phi16 Lv 1 81 pts. 9,963
  3. Avatar for lamoille 3. lamoille Lv 1 65 pts. 9,963
  4. Avatar for grogar7 4. grogar7 Lv 1 52 pts. 9,958
  5. Avatar for alcor29 5. alcor29 Lv 1 41 pts. 9,936
  6. Avatar for tokens 6. tokens Lv 1 32 pts. 9,929
  7. Avatar for actiasluna 7. actiasluna Lv 1 24 pts. 9,889
  8. Avatar for Blipperman 8. Blipperman Lv 1 18 pts. 9,887
  9. Avatar for Skippysk8s 9. Skippysk8s Lv 1 14 pts. 9,881
  10. Avatar for andrewxc 10. andrewxc Lv 1 10 pts. 9,876

Comments