Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for TePie 101. TePie Lv 1 1 pt. 8,487
  2. Avatar for bhfreagra 102. bhfreagra Lv 1 1 pt. 8,463
  3. Avatar for jakestorm777 103. jakestorm777 Lv 1 1 pt. 8,461
  4. Avatar for Knoblerine 104. Knoblerine Lv 1 1 pt. 8,450
  5. Avatar for rinze 105. rinze Lv 1 1 pt. 8,422
  6. Avatar for leehaggis 106. leehaggis Lv 1 1 pt. 8,421
  7. Avatar for Vincera 107. Vincera Lv 1 1 pt. 8,386
  8. Avatar for ViJay7019 108. ViJay7019 Lv 1 1 pt. 8,364
  9. Avatar for Deleted player 109. Deleted player pts. 8,348
  10. Avatar for lconor 110. lconor Lv 1 1 pt. 8,338

Comments