Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for TePie 101. TePie Lv 1 1 pt. 8,487
  2. Avatar for bhfreagra 102. bhfreagra Lv 1 1 pt. 8,463
  3. Avatar for jakestorm777 103. jakestorm777 Lv 1 1 pt. 8,461
  4. Avatar for Knoblerine 104. Knoblerine Lv 1 1 pt. 8,450
  5. Avatar for rinze 105. rinze Lv 1 1 pt. 8,422
  6. Avatar for leehaggis 106. leehaggis Lv 1 1 pt. 8,421
  7. Avatar for Vincera 107. Vincera Lv 1 1 pt. 8,386
  8. Avatar for ViJay7019 108. ViJay7019 Lv 1 1 pt. 8,364
  9. Avatar for Deleted player 109. Deleted player pts. 8,348
  10. Avatar for lconor 110. lconor Lv 1 1 pt. 8,338

Comments