Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for harvardman 121. harvardman Lv 1 1 pt. 8,125
  2. Avatar for pizpot 122. pizpot Lv 1 1 pt. 8,073
  3. Avatar for lamoille 123. lamoille Lv 1 1 pt. 8,005
  4. Avatar for dbuske 124. dbuske Lv 1 1 pt. 7,928
  5. Avatar for Savas 125. Savas Lv 1 1 pt. 7,904
  6. Avatar for centic 126. centic Lv 1 1 pt. 7,884
  7. Avatar for sstraus1 127. sstraus1 Lv 1 1 pt. 7,672
  8. Avatar for NotWeirdGifted 128. NotWeirdGifted Lv 1 1 pt. 7,654
  9. Avatar for TY2017 129. TY2017 Lv 1 1 pt. 7,526
  10. Avatar for dettingen 130. dettingen Lv 1 1 pt. 7,473

Comments