Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for harvardman 121. harvardman Lv 1 1 pt. 8,125
  2. Avatar for pizpot 122. pizpot Lv 1 1 pt. 8,073
  3. Avatar for lamoille 123. lamoille Lv 1 1 pt. 8,005
  4. Avatar for dbuske 124. dbuske Lv 1 1 pt. 7,928
  5. Avatar for Savas 125. Savas Lv 1 1 pt. 7,904
  6. Avatar for centic 126. centic Lv 1 1 pt. 7,884
  7. Avatar for sstraus1 127. sstraus1 Lv 1 1 pt. 7,672
  8. Avatar for NotWeirdGifted 128. NotWeirdGifted Lv 1 1 pt. 7,654
  9. Avatar for TY2017 129. TY2017 Lv 1 1 pt. 7,526
  10. Avatar for dettingen 130. dettingen Lv 1 1 pt. 7,473

Comments