Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for linehankai2 141. linehankai2 Lv 1 1 pt. 6,255
  2. Avatar for CAMPILLO 142. CAMPILLO Lv 1 1 pt. 5,784
  3. Avatar for livyatan0923 143. livyatan0923 Lv 1 1 pt. 5,673
  4. Avatar for smaxdrik 144. smaxdrik Lv 1 1 pt. 5,510
  5. Avatar for Giantbluefish 145. Giantbluefish Lv 1 1 pt. 5,507
  6. Avatar for chengrya000 146. chengrya000 Lv 1 1 pt. 5,488
  7. Avatar for 01010011111 147. 01010011111 Lv 1 1 pt. 5,484
  8. Avatar for Osama Goda 148. Osama Goda Lv 1 1 pt. 5,456
  9. Avatar for gulsahsimsir 149. gulsahsimsir Lv 1 1 pt. 5,333
  10. Avatar for Bruschetta 150. Bruschetta Lv 1 1 pt. 5,306

Comments