Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for linehankai2 141. linehankai2 Lv 1 1 pt. 6,255
  2. Avatar for CAMPILLO 142. CAMPILLO Lv 1 1 pt. 5,784
  3. Avatar for livyatan0923 143. livyatan0923 Lv 1 1 pt. 5,673
  4. Avatar for smaxdrik 144. smaxdrik Lv 1 1 pt. 5,510
  5. Avatar for Giantbluefish 145. Giantbluefish Lv 1 1 pt. 5,507
  6. Avatar for chengrya000 146. chengrya000 Lv 1 1 pt. 5,488
  7. Avatar for 01010011111 147. 01010011111 Lv 1 1 pt. 5,484
  8. Avatar for Osama Goda 148. Osama Goda Lv 1 1 pt. 5,456
  9. Avatar for gulsahsimsir 149. gulsahsimsir Lv 1 1 pt. 5,333
  10. Avatar for Bruschetta 150. Bruschetta Lv 1 1 pt. 5,306

Comments