Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for Mizraim 151. Mizraim Lv 1 1 pt. 5,272
  2. Avatar for Proteinslayer_FI 152. Proteinslayer_FI Lv 1 1 pt. 5,238
  3. Avatar for ireneyu22 153. ireneyu22 Lv 1 1 pt. 4,768
  4. Avatar for nicolas.c 154. nicolas.c Lv 1 1 pt. 4,757
  5. Avatar for Sequoia234 155. Sequoia234 Lv 1 1 pt. 4,755
  6. Avatar for Fire99 156. Fire99 Lv 1 1 pt. 0
  7. Avatar for ByrnCol19 157. ByrnCol19 Lv 1 1 pt. 0
  8. Avatar for Leo33 158. Leo33 Lv 1 1 pt. 0
  9. Avatar for DodoBird 159. DodoBird Lv 1 1 pt. 0
  10. Avatar for Hollinas 160. Hollinas Lv 1 1 pt. 0

Comments