Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121

  1. Avatar for Mizraim 151. Mizraim Lv 1 1 pt. 5,272
  2. Avatar for Proteinslayer_FI 152. Proteinslayer_FI Lv 1 1 pt. 5,238
  3. Avatar for ireneyu22 153. ireneyu22 Lv 1 1 pt. 4,768
  4. Avatar for nicolas.c 154. nicolas.c Lv 1 1 pt. 4,757
  5. Avatar for Sequoia234 155. Sequoia234 Lv 1 1 pt. 4,755
  6. Avatar for Fire99 156. Fire99 Lv 1 1 pt. 0
  7. Avatar for ByrnCol19 157. ByrnCol19 Lv 1 1 pt. 0
  8. Avatar for Leo33 158. Leo33 Lv 1 1 pt. 0
  9. Avatar for DodoBird 159. DodoBird Lv 1 1 pt. 0
  10. Avatar for Hollinas 160. Hollinas Lv 1 1 pt. 0

Comments