Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for phi16 11. phi16 Lv 1 74 pts. 9,784
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 71 pts. 9,782
  3. Avatar for Deleted player 13. Deleted player pts. 9,762
  4. Avatar for LociOiling 14. LociOiling Lv 1 67 pts. 9,756
  5. Avatar for Galaxie 15. Galaxie Lv 1 65 pts. 9,747
  6. Avatar for crpainter 16. crpainter Lv 1 63 pts. 9,712
  7. Avatar for Enzyme 17. Enzyme Lv 1 61 pts. 9,710
  8. Avatar for caglar 18. caglar Lv 1 59 pts. 9,693
  9. Avatar for eusair 19. eusair Lv 1 57 pts. 9,687
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 55 pts. 9,656

Comments