Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for phi16 11. phi16 Lv 1 74 pts. 9,784
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 71 pts. 9,782
  3. Avatar for Deleted player 13. Deleted player pts. 9,762
  4. Avatar for LociOiling 14. LociOiling Lv 1 67 pts. 9,756
  5. Avatar for Galaxie 15. Galaxie Lv 1 65 pts. 9,747
  6. Avatar for crpainter 16. crpainter Lv 1 63 pts. 9,712
  7. Avatar for Enzyme 17. Enzyme Lv 1 61 pts. 9,710
  8. Avatar for caglar 18. caglar Lv 1 59 pts. 9,693
  9. Avatar for eusair 19. eusair Lv 1 57 pts. 9,687
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 55 pts. 9,656

Comments