Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 53 pts. 9,617
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 51 pts. 9,605
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 49 pts. 9,602
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 48 pts. 9,596
  5. Avatar for hpaege 25. hpaege Lv 1 46 pts. 9,594
  6. Avatar for katling 26. katling Lv 1 44 pts. 9,542
  7. Avatar for Vinara 27. Vinara Lv 1 43 pts. 9,526
  8. Avatar for anthion 28. anthion Lv 1 41 pts. 9,520
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 40 pts. 9,519
  10. Avatar for drjr 30. drjr Lv 1 39 pts. 9,482

Comments