Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 53 pts. 9,617
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 51 pts. 9,605
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 49 pts. 9,602
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 48 pts. 9,596
  5. Avatar for hpaege 25. hpaege Lv 1 46 pts. 9,594
  6. Avatar for katling 26. katling Lv 1 44 pts. 9,542
  7. Avatar for Vinara 27. Vinara Lv 1 43 pts. 9,526
  8. Avatar for anthion 28. anthion Lv 1 41 pts. 9,520
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 40 pts. 9,519
  10. Avatar for drjr 30. drjr Lv 1 39 pts. 9,482

Comments