Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for benrh 71. benrh Lv 1 7 pts. 9,001
  2. Avatar for stomjoh 72. stomjoh Lv 1 7 pts. 8,992
  3. Avatar for RylandGomez 73. RylandGomez Lv 1 6 pts. 8,979
  4. Avatar for bzipitidoo 74. bzipitidoo Lv 1 6 pts. 8,976
  5. Avatar for ikalvet 75. ikalvet Lv 1 6 pts. 8,947
  6. Avatar for Renthel 76. Renthel Lv 1 5 pts. 8,945
  7. Avatar for micheldeweerd 77. micheldeweerd Lv 1 5 pts. 8,919
  8. Avatar for smilingone 78. smilingone Lv 1 5 pts. 8,902
  9. Avatar for Merf 79. Merf Lv 1 5 pts. 8,889
  10. Avatar for jermainiac 80. jermainiac Lv 1 4 pts. 8,888

Comments