Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for benrh 71. benrh Lv 1 7 pts. 9,001
  2. Avatar for stomjoh 72. stomjoh Lv 1 7 pts. 8,992
  3. Avatar for RylandGomez 73. RylandGomez Lv 1 6 pts. 8,979
  4. Avatar for bzipitidoo 74. bzipitidoo Lv 1 6 pts. 8,976
  5. Avatar for ikalvet 75. ikalvet Lv 1 6 pts. 8,947
  6. Avatar for Renthel 76. Renthel Lv 1 5 pts. 8,945
  7. Avatar for micheldeweerd 77. micheldeweerd Lv 1 5 pts. 8,919
  8. Avatar for smilingone 78. smilingone Lv 1 5 pts. 8,902
  9. Avatar for Merf 79. Merf Lv 1 5 pts. 8,889
  10. Avatar for jermainiac 80. jermainiac Lv 1 4 pts. 8,888

Comments