Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for pfirth 81. pfirth Lv 1 4 pts. 8,885
  2. Avatar for NotJim99 82. NotJim99 Lv 1 4 pts. 8,874
  3. Avatar for A_Pickle 83. A_Pickle Lv 1 4 pts. 8,862
  4. Avatar for Deleted player 84. Deleted player pts. 8,850
  5. Avatar for fpc 85. fpc Lv 1 3 pts. 8,844
  6. Avatar for momadoc 86. momadoc Lv 1 3 pts. 8,843
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 3 pts. 8,823
  8. Avatar for Alistair69 88. Alistair69 Lv 1 3 pts. 8,815
  9. Avatar for rabamino12358 89. rabamino12358 Lv 1 3 pts. 8,814
  10. Avatar for hada 90. hada Lv 1 3 pts. 8,802

Comments