Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for pfirth 81. pfirth Lv 1 4 pts. 8,885
  2. Avatar for NotJim99 82. NotJim99 Lv 1 4 pts. 8,874
  3. Avatar for A_Pickle 83. A_Pickle Lv 1 4 pts. 8,862
  4. Avatar for Deleted player 84. Deleted player pts. 8,850
  5. Avatar for fpc 85. fpc Lv 1 3 pts. 8,844
  6. Avatar for momadoc 86. momadoc Lv 1 3 pts. 8,843
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 3 pts. 8,823
  8. Avatar for Alistair69 88. Alistair69 Lv 1 3 pts. 8,815
  9. Avatar for rabamino12358 89. rabamino12358 Lv 1 3 pts. 8,814
  10. Avatar for hada 90. hada Lv 1 3 pts. 8,802

Comments