Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for Deleted player 11. Deleted player pts. 9,873
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 5 pts. 9,821
  3. Avatar for toshiue 13. toshiue Lv 1 4 pts. 9,809
  4. Avatar for jausmh 14. jausmh Lv 1 3 pts. 9,803
  5. Avatar for Hollinas 15. Hollinas Lv 1 2 pts. 9,799
  6. Avatar for Azukay 16. Azukay Lv 1 1 pt. 9,797
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 1 pt. 9,792
  8. Avatar for dettingen 18. dettingen Lv 1 1 pt. 9,781
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 1 pt. 9,772
  10. Avatar for LociOiling 20. LociOiling Lv 1 1 pt. 9,724

Comments