Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for freefolder 13. freefolder 2 pts. 9,372
  3. Avatar for xkcd 14. xkcd 1 pt. 9,302
  4. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  5. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  7. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  8. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021

  1. Avatar for joshmiller 161. joshmiller Lv 1 1 pt. 8,148

Comments