Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for freefolder 13. freefolder 2 pts. 9,372
  3. Avatar for xkcd 14. xkcd 1 pt. 9,302
  4. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  5. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  7. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  8. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021

  1. Avatar for nicobul 11. nicobul Lv 1 73 pts. 10,056
  2. Avatar for reefyrob 12. reefyrob Lv 1 71 pts. 10,045
  3. Avatar for pauldunn 13. pauldunn Lv 1 68 pts. 10,038
  4. Avatar for grogar7 14. grogar7 Lv 1 66 pts. 10,037
  5. Avatar for Azukay 15. Azukay Lv 1 64 pts. 10,019
  6. Avatar for crpainter 16. crpainter Lv 1 62 pts. 10,003
  7. Avatar for frood66 17. frood66 Lv 1 60 pts. 9,999
  8. Avatar for O Seki To 18. O Seki To Lv 1 58 pts. 9,998
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 56 pts. 9,984
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 54 pts. 9,981

Comments