Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for freefolder 13. freefolder 2 pts. 9,372
  3. Avatar for xkcd 14. xkcd 1 pt. 9,302
  4. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  5. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  7. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  8. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021

  1. Avatar for MicElephant 61. MicElephant Lv 1 10 pts. 9,736
  2. Avatar for Flagg65a 62. Flagg65a Lv 1 10 pts. 9,735
  3. Avatar for Vincera 63. Vincera Lv 1 9 pts. 9,720
  4. Avatar for cbwest 64. cbwest Lv 1 9 pts. 9,718
  5. Avatar for DoctorSockrates 65. DoctorSockrates Lv 1 8 pts. 9,711
  6. Avatar for SilentSnake1995 66. SilentSnake1995 Lv 1 8 pts. 9,699
  7. Avatar for SaraL 67. SaraL Lv 1 7 pts. 9,690
  8. Avatar for anthion 68. anthion Lv 1 7 pts. 9,688
  9. Avatar for mimi 69. mimi Lv 1 7 pts. 9,684
  10. Avatar for dbuske 70. dbuske Lv 1 6 pts. 9,666

Comments