Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Minions of TWIS 11. Minions of TWIS 3 pts. 9,539
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,504
  3. Avatar for Villanova ChE 13. Villanova ChE 1 pt. 9,445
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,351
  5. Avatar for freefolder 15. freefolder 1 pt. 9,338
  6. Avatar for NE224 F2017 16. NE224 F2017 1 pt. 9,283
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,227
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,156
  9. Avatar for Family Style Folding 19. Family Style Folding 1 pt. 9,132
  10. Avatar for Rechenkraft.net 20. Rechenkraft.net 1 pt. 9,067
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 76 pts. 10,122
  2. Avatar for crpainter 12. crpainter Lv 1 74 pts. 10,120
  3. Avatar for reefyrob 13. reefyrob Lv 1 72 pts. 10,120
  4. Avatar for Enzyme 14. Enzyme Lv 1 70 pts. 10,120
  5. Avatar for Deleted player 15. Deleted player pts. 10,108
  6. Avatar for pvc78 16. pvc78 Lv 1 66 pts. 10,099
  7. Avatar for nicobul 17. nicobul Lv 1 64 pts. 10,090
  8. Avatar for Deleted player 18. Deleted player pts. 10,087
  9. Avatar for Threeoak 19. Threeoak Lv 1 60 pts. 10,086
  10. Avatar for phi16 20. phi16 Lv 1 58 pts. 10,085

Comments