1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Summary

• Created: December 12, 2017
• Expires: December 19, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

• 11. Minions of TWIS 3 pts. 9,539
• 12. SETI.Germany 2 pts. 9,504
• 13. Villanova ChE 1 pt. 9,445
• 14. Richard Dawkins Foundation 1 pt. 9,351
• 15. freefolder 1 pt. 9,338
• 16. NE224 F2017 1 pt. 9,283
• 17. DSN @ Home 1 pt. 9,227
• 18. Team South Africa 1 pt. 9,156
• 19. Family Style Folding 1 pt. 9,132
• 20. Rechenkraft.net 1 pt. 9,067

Top soloists

• 31. toshiue 41 pts. 10,022
• 32. O Seki To 40 pts. 10,012
• 33. guineapig 39 pts. 10,010
• 34. DoctorSockrates 37 pts. 10,009
• 35. christioanchauvin 36 pts. 10,008
• 36. georg137 35 pts. 10,008
• 37. altejoh 34 pts. 10,004
• 38. MicElephant 33 pts. 9,998
• 39. Glen B 32 pts. 9,997
• 40. hpaege 31 pts. 9,996