Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692
  1. Avatar for ozanertekin 111. ozanertekin Lv 1 2 pts. 9,436
  2. Avatar for pielie 112. pielie Lv 1 1 pt. 9,436
  3. Avatar for Auntecedent 113. Auntecedent Lv 1 1 pt. 9,428
  4. Avatar for pfirth 114. pfirth Lv 1 1 pt. 9,423
  5. Avatar for dbuske 115. dbuske Lv 1 1 pt. 9,417
  6. Avatar for Ellis Shih 116. Ellis Shih Lv 1 1 pt. 9,407
  7. Avatar for rabamino12358 117. rabamino12358 Lv 1 1 pt. 9,399
  8. Avatar for Kevonni 118. Kevonni Lv 1 1 pt. 9,388
  9. Avatar for mitarcher 119. mitarcher Lv 1 1 pt. 9,383
  10. Avatar for gstelle 120. gstelle Lv 1 1 pt. 9,381

Comments