Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692
  1. Avatar for momadoc 131. momadoc Lv 1 1 pt. 9,311
  2. Avatar for Master of Games 132. Master of Games Lv 1 1 pt. 9,309
  3. Avatar for muhammedakd 133. muhammedakd Lv 1 1 pt. 9,296
  4. Avatar for rdtoyona 134. rdtoyona Lv 1 1 pt. 9,283
  5. Avatar for pruneau_44 135. pruneau_44 Lv 1 1 pt. 9,282
  6. Avatar for smais 136. smais Lv 1 1 pt. 9,269
  7. Avatar for elcinelif 137. elcinelif Lv 1 1 pt. 9,262
  8. Avatar for lconor 138. lconor Lv 1 1 pt. 9,246
  9. Avatar for aspadistra 139. aspadistra Lv 1 1 pt. 9,227
  10. Avatar for baiyuncanggou 140. baiyuncanggou Lv 1 1 pt. 9,219

Comments