1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Summary

• Created: December 12, 2017
• Expires: December 19, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

• 1. Beta Folders 100 pts. 10,248
• 2. Go Science 77 pts. 10,247
• 3. Marvin's bunch 58 pts. 10,202
• 4. Anthropic Dreams 43 pts. 10,186
• 5. Gargleblasters 31 pts. 10,178
• 6. Contenders 22 pts. 10,120
• 7. L'Alliance Francophone 15 pts. 10,090
• 8. Void Crushers 11 pts. 10,041
• 9. HMT heritage 7 pts. 10,012
• 10. GENE 433 5 pts. 9,692

Top soloists

• 21. Tehnologik1 57 pts. 10,084
• 22. Blipperman 55 pts. 10,077
• 23. smilingone 53 pts. 10,075
• 24. NinjaGreg 52 pts. 10,072
• 25. johnmitch 50 pts. 10,069
• 26. fiendish_ghoul 48 pts. 10,067
• 27. alcor29 47 pts. 10,053
• 28. Timo van der Laan 46 pts. 10,041
• 29. SKSbell 44 pts. 10,034
• 30. Flagg65a 43 pts. 10,030