Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692
  1. Avatar for stomjoh 41. stomjoh Lv 1 30 pts. 9,994
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 29 pts. 9,987
  3. Avatar for caglar 43. caglar Lv 1 28 pts. 9,981
  4. Avatar for TastyMunchies 44. TastyMunchies Lv 1 27 pts. 9,973
  5. Avatar for diamonddays 45. diamonddays Lv 1 26 pts. 9,971
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 25 pts. 9,968
  7. Avatar for manu8170 47. manu8170 Lv 1 24 pts. 9,967
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 23 pts. 9,963
  9. Avatar for Vinara 49. Vinara Lv 1 22 pts. 9,956
  10. Avatar for drjr 50. drjr Lv 1 22 pts. 9,949

Comments