Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for leehaggis 91. leehaggis Lv 1 2 pts. 9,446
  2. Avatar for fishercat 92. fishercat Lv 1 2 pts. 9,438
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 2 pts. 9,435
  4. Avatar for multaq 94. multaq Lv 1 2 pts. 9,423
  5. Avatar for jmshook 95. jmshook Lv 1 2 pts. 9,409
  6. Avatar for pfirth 96. pfirth Lv 1 2 pts. 9,408
  7. Avatar for senor pit 97. senor pit Lv 1 2 pts. 9,405
  8. Avatar for Simek 98. Simek Lv 1 2 pts. 9,403
  9. Avatar for abiogenesis 99. abiogenesis Lv 1 2 pts. 9,395
  10. Avatar for lamoille 100. lamoille Lv 1 1 pt. 9,394

Comments