Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for Enzyme 11. Enzyme Lv 1 73 pts. 9,755
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 71 pts. 9,744
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 69 pts. 9,743
  4. Avatar for phi16 14. phi16 Lv 1 66 pts. 9,742
  5. Avatar for fpc 15. fpc Lv 1 64 pts. 9,736
  6. Avatar for pauldunn 16. pauldunn Lv 1 62 pts. 9,736
  7. Avatar for Blipperman 17. Blipperman Lv 1 60 pts. 9,735
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 58 pts. 9,733
  9. Avatar for diamonddays 19. diamonddays Lv 1 56 pts. 9,723
  10. Avatar for Deleted player 20. Deleted player pts. 9,722

Comments