Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348

  1. Avatar for katling 61. katling Lv 1 11 pts. 9,610
  2. Avatar for altejoh 62. altejoh Lv 1 10 pts. 9,606
  3. Avatar for Deleted player 63. Deleted player pts. 9,594
  4. Avatar for alcor29 64. alcor29 Lv 1 9 pts. 9,593
  5. Avatar for stomjoh 65. stomjoh Lv 1 9 pts. 9,593
  6. Avatar for anthion 66. anthion Lv 1 8 pts. 9,587
  7. Avatar for SKSbell 68. SKSbell Lv 1 8 pts. 9,583
  8. Avatar for szescian 69. szescian Lv 1 7 pts. 9,565
  9. Avatar for dbuske 70. dbuske Lv 1 7 pts. 9,564

Comments