Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348

  1. Avatar for katling 61. katling Lv 1 11 pts. 9,610
  2. Avatar for altejoh 62. altejoh Lv 1 10 pts. 9,606
  3. Avatar for Deleted player 63. Deleted player pts. 9,594
  4. Avatar for alcor29 64. alcor29 Lv 1 9 pts. 9,593
  5. Avatar for stomjoh 65. stomjoh Lv 1 9 pts. 9,593
  6. Avatar for anthion 66. anthion Lv 1 8 pts. 9,587
  7. Avatar for SKSbell 68. SKSbell Lv 1 8 pts. 9,583
  8. Avatar for szescian 69. szescian Lv 1 7 pts. 9,565
  9. Avatar for dbuske 70. dbuske Lv 1 7 pts. 9,564

Comments