Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348

  1. Avatar for DoctorSockrates 71. DoctorSockrates Lv 1 7 pts. 9,558
  2. Avatar for alwen 72. alwen Lv 1 6 pts. 9,558
  3. Avatar for 181818 73. 181818 Lv 1 6 pts. 9,553
  4. Avatar for Glen B 74. Glen B Lv 1 6 pts. 9,549
  5. Avatar for kyky 75. kyky Lv 1 5 pts. 9,541
  6. Avatar for SaraL 76. SaraL Lv 1 5 pts. 9,536
  7. Avatar for isaksson 77. isaksson Lv 1 5 pts. 9,522
  8. Avatar for petetrig 78. petetrig Lv 1 5 pts. 9,518
  9. Avatar for mitarcher 79. mitarcher Lv 1 4 pts. 9,516

Comments