Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023

  1. Avatar for gurch 51. gurch Lv 1 17 pts. 9,012
  2. Avatar for toshiue 52. toshiue Lv 1 16 pts. 8,983
  3. Avatar for Merf 53. Merf Lv 1 15 pts. 8,946
  4. Avatar for weitzen 54. weitzen Lv 1 14 pts. 8,920
  5. Avatar for Azukay 55. Azukay Lv 1 14 pts. 8,915
  6. Avatar for manu8170 56. manu8170 Lv 1 13 pts. 8,900
  7. Avatar for diamonddays 57. diamonddays Lv 1 13 pts. 8,895
  8. Avatar for YGK 58. YGK Lv 1 12 pts. 8,888
  9. Avatar for robgee 59. robgee Lv 1 12 pts. 8,885
  10. Avatar for SaraL 60. SaraL Lv 1 11 pts. 8,880

Comments