Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for katling 41. katling Lv 1 25 pts. 9,077
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 24 pts. 9,076
  3. Avatar for Maerlyn138 43. Maerlyn138 Lv 1 23 pts. 9,061
  4. Avatar for Vinara 44. Vinara Lv 1 22 pts. 9,056
  5. Avatar for drjr 45. drjr Lv 1 21 pts. 9,054
  6. Avatar for jobo0502 46. jobo0502 Lv 1 20 pts. 9,039
  7. Avatar for heather-1 47. heather-1 Lv 1 20 pts. 9,036
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 19 pts. 9,024
  9. Avatar for Sissue 49. Sissue Lv 1 18 pts. 9,023
  10. Avatar for dizzywings 50. dizzywings Lv 1 17 pts. 9,019

Comments