Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for PM/01/2018 11. PM/01/2018 5 pts. 9,710
  2. Avatar for Deleted group 12. Deleted group pts. 9,696
  3. Avatar for BCC 13. BCC 2 pts. 9,682
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 9,614
  5. Avatar for Russian team 15. Russian team 1 pt. 9,577
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,500
  7. Avatar for Deleted group 17. Deleted group pts. 9,405
  8. Avatar for KNBIBS@MIMUW 18. KNBIBS@MIMUW 1 pt. 9,337
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,303
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 9,244
  1. Avatar for frood66 51. frood66 Lv 1 17 pts. 9,865
  2. Avatar for Maerlyn138 52. Maerlyn138 Lv 1 16 pts. 9,862
  3. Avatar for hpaege 53. hpaege Lv 1 15 pts. 9,858
  4. Avatar for Glen B 54. Glen B Lv 1 14 pts. 9,852
  5. Avatar for caglar 55. caglar Lv 1 14 pts. 9,845
  6. Avatar for tarimo 56. tarimo Lv 1 13 pts. 9,845
  7. Avatar for Blipperman 57. Blipperman Lv 1 13 pts. 9,844
  8. Avatar for sharondipity 58. sharondipity Lv 1 12 pts. 9,841
  9. Avatar for isaksson 59. isaksson Lv 1 12 pts. 9,836
  10. Avatar for Fat Tony 60. Fat Tony Lv 1 11 pts. 9,835

Comments