Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816
  1. Avatar for frood66 51. frood66 Lv 1 17 pts. 9,865
  2. Avatar for Maerlyn138 52. Maerlyn138 Lv 1 16 pts. 9,862
  3. Avatar for hpaege 53. hpaege Lv 1 15 pts. 9,858
  4. Avatar for Glen B 54. Glen B Lv 1 14 pts. 9,852
  5. Avatar for caglar 55. caglar Lv 1 14 pts. 9,845
  6. Avatar for tarimo 56. tarimo Lv 1 13 pts. 9,845
  7. Avatar for Blipperman 57. Blipperman Lv 1 13 pts. 9,844
  8. Avatar for sharondipity 58. sharondipity Lv 1 12 pts. 9,841
  9. Avatar for isaksson 59. isaksson Lv 1 12 pts. 9,836
  10. Avatar for Fat Tony 60. Fat Tony Lv 1 11 pts. 9,835

Comments