Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for PM/01/2018 11. PM/01/2018 5 pts. 9,710
  2. Avatar for Deleted group 12. Deleted group pts. 9,696
  3. Avatar for BCC 13. BCC 2 pts. 9,682
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 9,614
  5. Avatar for Russian team 15. Russian team 1 pt. 9,577
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,500
  7. Avatar for Deleted group 17. Deleted group pts. 9,405
  8. Avatar for KNBIBS@MIMUW 18. KNBIBS@MIMUW 1 pt. 9,337
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,303
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 9,244
  1. Avatar for altejoh 61. altejoh Lv 1 11 pts. 9,831
  2. Avatar for frostschutz 62. frostschutz Lv 1 10 pts. 9,828
  3. Avatar for NinjaGreg 63. NinjaGreg Lv 1 10 pts. 9,825
  4. Avatar for rezaefar 64. rezaefar Lv 1 9 pts. 9,819
  5. Avatar for MicElephant 65. MicElephant Lv 1 9 pts. 9,817
  6. Avatar for Cagdason 66. Cagdason Lv 1 8 pts. 9,816
  7. Avatar for katling 67. katling Lv 1 8 pts. 9,815
  8. Avatar for tokens 68. tokens Lv 1 8 pts. 9,803
  9. Avatar for Alistair69 69. Alistair69 Lv 1 7 pts. 9,800
  10. Avatar for tamanrasset 70. tamanrasset Lv 1 7 pts. 9,793

Comments