Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816
  1. Avatar for altejoh 61. altejoh Lv 1 11 pts. 9,831
  2. Avatar for frostschutz 62. frostschutz Lv 1 10 pts. 9,828
  3. Avatar for NinjaGreg 63. NinjaGreg Lv 1 10 pts. 9,825
  4. Avatar for rezaefar 64. rezaefar Lv 1 9 pts. 9,819
  5. Avatar for MicElephant 65. MicElephant Lv 1 9 pts. 9,817
  6. Avatar for Cagdason 66. Cagdason Lv 1 8 pts. 9,816
  7. Avatar for katling 67. katling Lv 1 8 pts. 9,815
  8. Avatar for tokens 68. tokens Lv 1 8 pts. 9,803
  9. Avatar for Alistair69 69. Alistair69 Lv 1 7 pts. 9,800
  10. Avatar for tamanrasset 70. tamanrasset Lv 1 7 pts. 9,793

Comments