Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for Vincera 91. Vincera Lv 1 2 pts. 9,626
  2. Avatar for versat82 92. versat82 Lv 1 2 pts. 9,614
  3. Avatar for alwen 93. alwen Lv 1 2 pts. 9,613
  4. Avatar for benrh 94. benrh Lv 1 2 pts. 9,604
  5. Avatar for abiogenesis 95. abiogenesis Lv 1 2 pts. 9,588
  6. Avatar for drjr 96. drjr Lv 1 2 pts. 9,584
  7. Avatar for Keresto 97. Keresto Lv 1 2 pts. 9,582
  8. Avatar for mitarcher 98. mitarcher Lv 1 2 pts. 9,580
  9. Avatar for ComputerMage 99. ComputerMage Lv 1 2 pts. 9,577
  10. Avatar for Arne Heessels 100. Arne Heessels Lv 1 1 pt. 9,576

Comments