Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816

  1. Avatar for Vincera 91. Vincera Lv 1 2 pts. 9,626
  2. Avatar for versat82 92. versat82 Lv 1 2 pts. 9,614
  3. Avatar for alwen 93. alwen Lv 1 2 pts. 9,613
  4. Avatar for benrh 94. benrh Lv 1 2 pts. 9,604
  5. Avatar for abiogenesis 95. abiogenesis Lv 1 2 pts. 9,588
  6. Avatar for drjr 96. drjr Lv 1 2 pts. 9,584
  7. Avatar for Keresto 97. Keresto Lv 1 2 pts. 9,582
  8. Avatar for mitarcher 98. mitarcher Lv 1 2 pts. 9,580
  9. Avatar for ComputerMage 99. ComputerMage Lv 1 2 pts. 9,577
  10. Avatar for Arne Heessels 100. Arne Heessels Lv 1 1 pt. 9,576

Comments