Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 73 pts. 10,034
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 71 pts. 10,022
  3. Avatar for andrewxc 13. andrewxc Lv 1 69 pts. 10,018
  4. Avatar for crpainter 14. crpainter Lv 1 66 pts. 10,013
  5. Avatar for pauldunn 15. pauldunn Lv 1 64 pts. 10,007
  6. Avatar for dizzywings 16. dizzywings Lv 1 62 pts. 9,991
  7. Avatar for Threeoak 17. Threeoak Lv 1 60 pts. 9,988
  8. Avatar for nicobul 18. nicobul Lv 1 58 pts. 9,979
  9. Avatar for alcor29 19. alcor29 Lv 1 56 pts. 9,973
  10. Avatar for Jim Fraser 20. Jim Fraser Lv 1 54 pts. 9,965

Comments