Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 73 pts. 10,034
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 71 pts. 10,022
  3. Avatar for andrewxc 13. andrewxc Lv 1 69 pts. 10,018
  4. Avatar for crpainter 14. crpainter Lv 1 66 pts. 10,013
  5. Avatar for pauldunn 15. pauldunn Lv 1 64 pts. 10,007
  6. Avatar for dizzywings 16. dizzywings Lv 1 62 pts. 9,991
  7. Avatar for Threeoak 17. Threeoak Lv 1 60 pts. 9,988
  8. Avatar for nicobul 18. nicobul Lv 1 58 pts. 9,979
  9. Avatar for alcor29 19. alcor29 Lv 1 56 pts. 9,973
  10. Avatar for Jim Fraser 20. Jim Fraser Lv 1 54 pts. 9,965

Comments